SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QDT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QDT7
Domain Number 1 Region: 456-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 203-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.73e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 260-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.39e-22
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.28e-22
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 137-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-19
Family KRAB domain (Kruppel-associated box) 0.00062
Further Details:      
 
Domain Number 8 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-19
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 9 Region: 581-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.61e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 10 Region: 502-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000133
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 418-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000266
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 12 Region: 94-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000205
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6QDT7
Sequence length 640
Comment (tr|F6QDT7|F6QDT7_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000010676} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
DSVAIEDVAVKFTPEEWALLDPSQKKLYRDVMQETFRHLASVGKTWEGHDIEDQHKNLGR
KQRSPLVGRLSESEEGSQCGENVSLIPNLSVNKKTTGGEPCECSDCGKVFRHHSSIKRQV
RCHTEHKQDDYQKYAEKPYVCKECEKAFLFPSSLRAHERTHTGEKPYECEECGKAFTAPS
SLRSHMISHTGDGPYKCKACEKAFITPSSLQIHGRRHTGEKPYECKHCSKAFSLPSVLEI
HERTHTGEKPYQCKECGKAFIALKNLRAHMVTHTGDGPYKCKECGKAFIYPSSLQIHERS
HTGEKPYECKKCNKVFACSSSLGVHERTHTREKPYECKECGQAFRACSSLRSHMMLHTAH
GPYKCKECGKAFIYPSSLQTHERSHTGEKPYECKKCDKVFACSSSLGAHERTHTREKPYE
CKECGQAFRARSSLRSHMMLHTRDGPYKCKECGKLFISPSSLQRHERSHTGEKPYECKKC
NKVFTSSSSLLVHERTHTGEKPYKCKECGKAFIALRSLQSHVMRHTGDGPYKCKECEKAF
ISPSSLRRHGRSHTGEKPYECKECSKAFTSSSYLRIHERTHTGEKPYECKKCSKAFHVAS
SLQRHERTHTGEKPYECKNCSKAFGYSSSLRKHERTHTGE
Download sequence
Identical sequences F6QDT7
ENSECAP00000010676 ENSECAP00000010676 9796.ENSECAP00000010676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]