SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QGV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QGV2
Domain Number 1 Region: 1836-1960
Classification Level Classification E-value
Superfamily CalX-like 6.15e-22
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1722-1836
Classification Level Classification E-value
Superfamily CalX-like 7.59e-22
Family CalX-beta domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1963-2077
Classification Level Classification E-value
Superfamily CalX-like 4.97e-19
Family CalX-beta domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6QGV2
Sequence length 2086
Comment (tr|F6QGV2|F6QGV2_HORSE) FRAS1 related extracellular matrix 3 {ECO:0000313|Ensembl:ENSECAP00000022004} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=FREM3 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
LHLPTWGALGCSSRDGPSVLIANPVLRVPVGRSLWLDPLRDLVIRVQPGDRCEVTVLDAL
PLHHGALSPRRFPCAFGPRQVRYTHFGSRSPGRGRVRLQLLCEAPTYTLALRFTVAVVVV
FSHLELVTRNAPLAVEKLRGWSPATDRRVLDFASLDARRCWLIPLPPEGGPLPRYGRLVD
AVGVPLTRGKGIDCEAFVLAGVRYQHTATTPSPNRDYVPMVVELLGREDRGAGSVEVLLP
EHFQLLVRILEGAENTTPKPSFEAVMMMEVDQFLLTALTPDALAAEDMESDPDDLVFNVL
KAPTTTSGHQGYLVSTDDPLGLPVSFFTQRELRELTIAYQPPTEKLDGEHLFQLELEVMD
GDGATSDPFAFMVLVKSMNILAPVASYNRGLLLFEGQSRPLSSAHNLQISDNSNPEELKV
AAVRGLRHGQLVVLGAPAGCKHFPPVDLAAGRVVYQHDGSDTYSDNIIFQMKDWHNHVEF
LFPVTIIPVDDEPPMVSANTGLSVTEGQVVQISPFVLSATDIDSEDSTICFVLEDQPLEE
KEEERGWDLAAGSSHSSQLLGEMLLRQVEPPLSSEEEDWHYVGKEGLYETVVTEWLQRDI
MEGKVFYHHLGPHSPQSVMTQLTFHVQDDHDPPNLSKQHFFTIKFQPVDLQSPELFPGTT
LEMTVQEYQLTHFQKKFLQYIDQDSDDQNLWYTLLTPPTDTDGNHPVQAGDIVLTDSPDT
PIVHFTQAQMNHHKVAYQPPQKKLGIVPRVVQFTYQVKDAAGNSITGTFTLFLKPVDNQP
PVVTNRGFTVLEGESFILSSNELDVTDPDTDIDQIVFMLVWGPQHGHLQYLKKCMVLGES
FRQADIINGSVSYQHSRDQSTSDTFHLEVSDRVHHVPITVKISVHPTAADRSPRISFTGS
SLLDVSTDVLENRATEITMGIIHGKRKGTRDLMLSFIMENSPQLGTILVNGLPTEQFTQE
DLISGAVVYVHTGGEVGFQKQHDTFSFAVSKGSYQWVVGDSIVERVQVQVIVLPVDNVVP
KVLVREAYIVYEGGKSPLTLEHLNIEDVDTPQDEILCTVTGQPASGYLENIAPAPGSEVS
QAGSPISAFSIRDVQMMHINYIQSIHKGVEPQEDQFIFYCSDGINFSPNIFFPIIILPTN
DEQPELFARKFVVLEGMSLVIDTPLLNGADADLPPNELHFQLTALPRHGRIIRQLATGSQ
PIHSFTLQEIQEASTIVYEHDDSETSEDSFEVWLSDGKHTTHRKVPIVVILVDDETPRLT
INGGLELETGHTAVITNQVLKATDLDSDDKRLSFVLRSGPQQGLLQRLRQPKGEVRNNLT
LGMNFTQDEIDRGLICYTHTGQEGVLDLIKFDVTDGVNHLIDRYFYVTIGSLDRVFLKVI
SKGVTLTEGGRVALTTDLLSTSDINSSDEQLHFSITQAPSLGHLESSDHPGEPIASFTQL
QLAGNKLFYVHTSNDEIKMDSFVFQVTDGHNPVFQTIRIFITDVDNKKPILTIHKLILQE
GESKLITPFELTVEDKDTPDDLLLFSITQVPFHGKILYNGSHPVTTFTKRDLNENLISYW
HNGSETTEDSFSLTVTDGTHADFYVFPDTALETHKPQVMKIHICPLDNRLPQIAVNRGAP
ALKHLHTGHVDFLITNKSLKAEHQDGPHRLLKYKVTRGPEHGFIINTGLGNESTRVFTQA
DIDEMRMHYILNEGSKATEDVFYLSVEDNGGNKLTNQPFLLNWAWISLEKEYYIVDEDSM
FLEVTLTCRGYLGETSFISIVTKDETAKKDKDFKGKAQKQIQFNPGQTTATWRMRIISDN
EYEVSETFQIILLDPVMAALEFPEMATIEIIDPGDESTVHIPEAEYKIEEDVGELLIPVR
RSGDASQELTVVCSTRQGSATGTISSTMLSLSDYVSRPKDHTSTLRFDKDETEKTCQVLI
IDDSLYEEEESFSVSLSLPIGGQLGAKFPSTKVIIQADRDDEPALHFGDAEYHVEESAGS
VEVCVWRTGTDLSQASSVAVRSRRTETASAEAGIDYIGVSRNLDFAPGVRMQIFQVTILD
DPEKPILEGPERFELFLQMPMGAVLGEPNKTTIFINDTITDCEQSA
Download sequence
Identical sequences F6QGV2
9796.ENSECAP00000022004 ENSECAP00000022004 ENSECAP00000022004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]