SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QGW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QGW1
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.14e-29
Family Hemopexin-like domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6QGW1
Sequence length 155
Comment (tr|F6QGW1|F6QGW1_MOUSE) Matrix metalloproteinase {ECO:0000256|RuleBase:RU364080} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Mmp11 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
XGAQYWVYDGEKPVLGPAPLSKLGLQGSPVHAALVWGPEKNKIYFFRGGDYWRFHPRTQR
VDNPVPRRSTDWRGVPSEIDAAFQDAEGYAYFLRGHLYWKFDPVKVIQTSASWNSGQKVH
SQPRRQLLPPRDTEPQRPHIPHSLAPGHFFLGPSS
Download sequence
Identical sequences F6QGW1
ENSMUSP00000116279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]