SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QH03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QH03
Domain Number 1 Region: 124-333
Classification Level Classification E-value
Superfamily vWA-like 5.7e-57
Family Integrin A (or I) domain 0.00037
Further Details:      
 
Domain Number 2 Region: 356-523
Classification Level Classification E-value
Superfamily Fibronectin type III 2.41e-21
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 3 Region: 627-804
Classification Level Classification E-value
Superfamily Fibronectin type III 1.23e-19
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 536-622
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000188
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 825-962
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000712
Family Leech intramolecular trans-sialidase, N-terminal domain 0.096
Further Details:      
 
Domain Number 6 Region: 1-72
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000518
Family Fibronectin type III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6QH03
Sequence length 1276
Comment (tr|F6QH03|F6QH03_MONDO) Collagen type XX alpha 1 chain {ECO:0000313|Ensembl:ENSMODP00000021037} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=COL20A1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
LRLTVLSEDRLQMKWKESEGNTNGYKVQVKPMAGRDSEQEVMLTTKTPKVTVVGLSPTKE
YTLQIFALSGSRDTLLARRRFVIEDLKSISTGRNSRKPSGETLEFIPSSVGNHEFDQVPE
LEVASPTWSGVSPTLAVSASIFQGPQFYCDTSIPVDIVFLVDGSWSIGRSNFRLIREFLA
NVISPFHIAQDKVRIGLSQYSGDPRTEWNLNSFSTKEDILEAIRNLRYKGGNTFTGLALT
HVLEQNLKLEAGSRSEAVKVVILLTDGKSQDDAGLAAQVLKDVGIDIFAIGVKNADESEL
THLASLPLDVTVHNVLDFPLLGNLTSRLIRLLCWKIQERSRSRDPGEGIHLWPHPSPTNL
IVSEVTASGFRLAWTPPLEPARKYRIIYHPSRGGTPREVTVEGATSSAQLLNLTSNTEYL
VTVFPVYKDGVGEGLRDIVTTLPLSPPSSLTIFSVDHNSIHLTWKPSNKATEYLVHCTSS
ASLREQEADEEEEVRDPEVLLKGLAPGTEYSIAVYALFGEEISEPQSIQAKTLSLDLPKH
LSFSEVSHSSVRVHWEASLRGVRMYHVSYVSLEGNQAGEIDVSRNASSVNLAPLSSSTSY
IVSVTSVYKDGDSSTLTGRVTTRKVPAPSHLKVTELPGDDVRLEWAAAAASGVVVYQIKW
TPLGEGKAYEISVPGNLGTATLPGLGKHAEYEISILAYYRDGARSDTVSLQYTPNNVFSA
AVSRNPPLNLVLASETPSSLRILWTSPNDNVLHYRLTYALASGSGPEKTIIVPGPENHVT
LPLLLPGTKYKVMVSAVYSLGESKVVSAIGRTAACPALHANNSLPGFDMMEAFGLVEKYA
SIKGVSVEPSIFSGTRIYTLFRDVQLMRRARAREIHPAALPPEHTISFLLRVLPETPREP
FALWQITDETFEPLLGVTLDAGRKSLAYFNRDHKAELQEVTFDLQEVKKIFYGSFHKVSI
LLRRLALYQFMQIFVSLNPLIMGLSSTYSLNVSLMVRRRRTVTPRQADYHCWNGVSWARK
MGKCFLSFQRDAETCPALASTCTCSLDQPGPPGPPGPPGTPGRRGIQGEQGTPGPRGEPG
PPGQTGPEGPGGQQGSPGTQGLTVQGPVGPPGLKGEKGDIGHPGLQGHPGHQGPPGRHGL
QGPKGMRGFEGTAGFPGPPGPRGFQGIAGARGINGEKGSPGDVGPTGLPGPKGERGEKGE
PQSLATIYQLVSQACEQLIQTHVLKFDPYLHENTRPPVPVWEEDVKPGKPGLPGLPNLPG
QKGDRGKDGFPGERGR
Download sequence
Identical sequences F6QH03
13616.ENSMODP00000021037 ENSMODP00000021037 ENSMODP00000021037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]