SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QHZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QHZ1
Domain Number 1 Region: 351-488
Classification Level Classification E-value
Superfamily C-type lectin-like 7.26e-43
Family C-type lectin domain 0.00011
Further Details:      
 
Domain Number 2 Region: 803-947
Classification Level Classification E-value
Superfamily C-type lectin-like 5.23e-36
Family C-type lectin domain 0.00044
Further Details:      
 
Domain Number 3 Region: 213-342
Classification Level Classification E-value
Superfamily C-type lectin-like 1.18e-33
Family C-type lectin domain 0.00032
Further Details:      
 
Domain Number 4 Region: 942-1094
Classification Level Classification E-value
Superfamily C-type lectin-like 4.97e-33
Family C-type lectin domain 0.00063
Further Details:      
 
Domain Number 5 Region: 1105-1231
Classification Level Classification E-value
Superfamily C-type lectin-like 6.8e-31
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 6 Region: 498-629
Classification Level Classification E-value
Superfamily C-type lectin-like 7.76e-31
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 7 Region: 637-784
Classification Level Classification E-value
Superfamily C-type lectin-like 1.01e-28
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 8 Region: 1249-1379
Classification Level Classification E-value
Superfamily C-type lectin-like 8.76e-25
Family C-type lectin domain 0.0045
Further Details:      
 
Domain Number 9 Region: 151-208
Classification Level Classification E-value
Superfamily Kringle-like 4.85e-20
Family Fibronectin type II module 0.00059
Further Details:      
 
Domain Number 10 Region: 22-150
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.07e-17
Family Cysteine rich domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6QHZ1
Sequence length 1472
Comment (tr|F6QHZ1|F6QHZ1_XENTR) Mannose receptor, C type 2 {ECO:0000313|Ensembl:ENSXETP00000011706} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=mrc2 OC=Silurana.
Sequence
FREPHYGAVSSIIILIFIILENAPFAIYSPEVGGCLAVRDSVVGLQWSCNDSSLDQQWLW
VSRRRLFNLGSLQCLWVPSLSNGTSSTISVLPCDHENFHTIRRCEAQLEQLSNALFPQTT
NTTSLQEPPAKSAIQWLINGTNRSICSAVFWDIYTIQGNSNGRPCAIPFKYDNQWFYSCT
STGREDGHLWCATTVDYGKDEKWGFCPVKSDDCEAFWDKDPLTQNCYQFNFQSALSWSEA
WTSCRQQDAHLLSITEIHEQTYINGLLTGYTSTLWMGLNDLDTNGGWQWSNGSPLKYLNW
ESGKPSNSMEENCAVIRTESLGAWQNRVCGNALPYACKKSPGSSRRSLPIEPQEPDVAID
CDPGWQSFGTNCYRVNSEKKTWQEARKACVRVEANLVSIHSMLELEFVSKQINYPYVEEL
WIGLNDLKHQMNFEWSDGSSVTFTSWHPFEPNNFRDSMEDCVTIWGPEGRWNDSPCNQTL
PSICKKPGNFNQGGKVDTHGCQKGWSWHSPSCYWLSDESVTYSEATKACSDRQAMLATVH
NRFDQAYVNSLLYGSEGSYYWTALQDINDTGTFRWLEGEEVIYTHWNRDQPGYDKGGCVA
LATGRSLGLWEVKNCVEFRAKYICMQTLVTLTPLIPARPIPSLNGSCSDGWNSAPNLRYC
YKVYHSEKLQDKKTWISAQLACREIGAQLLSVSSVEEEHFVGHLLKESDTDFHEQHWFWI
GLNRRNPSGEQGWVWSDGQGYSYHNFDRSNHDDDDIRRCVVLDLSSLQWVALECESQMDW
ICKLPKGNIPQQTFNKTPQMTPHSHTPSSSEWITNENAQYKFFEHHSTWLQAQRICSWFS
AELVSIHNQAELDFLGQSLQKFSRGQEQHWWIGLHTYENDGRFRWSDRSVLSFVNWASGR
PRPISREKKCVYMTASRGDWGDQKCDTALPYICKRTNNTLPVPTTPPIPTNTGGGCPRSW
LPFLNKCFGVRADSKAETKTWQQARDSCKVLGGELATINNYLEQAFITSILPNITFDLWI
GLHNARKQFQWVEGQVLNYVNWAPREPSGYGTSGSSEKPINCAVVWHGSPPPFTGRWDDR
NCLEEKHGYICQISKVASLNPPAEPFPPAPGSILRYMNNTYVILQKPMTWSDARLLCETR
NATLSSIPDPYQQAYLTLAVTGLKTPVWIGLSNEEGGRSYSWLTNDSLSYTNWRDGEPQL
MSGCVYMDFQGTWSTANCESKLQGAVCKFNTESRKMHKWSEAGNCPRSLSDSSWIPFRDN
CYSFHMEIRVSQREAAKKCHKVGGEVLSILDETENVFVWEHLQAYESQSRGAWLGMSFNA
KGGGLVWNDNSPVNYSNWGQQDAGPSLLSPNSCYWVQGSNGVWSLGSCTNNTMGVICKLS
RAYRDACRPTHCLSCSVPTVFPEHTTAVAVVILSTTALCVLLVVVIYLYRRRKHAAELGA
FESARYSRTSTGPGGSAEKNILVSDMEMNEQQ
Download sequence
Identical sequences F6QHZ1
ENSXETP00000011706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]