SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QJR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QJR4
Domain Number 1 Region: 275-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000031
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 2 Region: 219-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000372
Family EGF-type module 0.028
Further Details:      
 
Domain Number 3 Region: 338-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  F6QJR4
Domain Number - Region: 402-434
Classification Level Classification E-value
Superfamily TIMP-like 0.00745
Family Tissue inhibitor of metalloproteinases, TIMP 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6QJR4
Sequence length 441
Comment (tr|F6QJR4|F6QJR4_HORSE) Netrin 3 {ECO:0000313|Ensembl:ENSECAP00000015708} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=NTN3 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
GAPRSCVPALLNAALGAEVLASSTCGRPATRVCDGNPRRAHPAALLTSAGSTAPVCWRSD
SLRKAPLNVTLTVPLGKAFELVFVSLRFCSAPPASVALLKSQDHGRSWAPLGFFSSHCGL
DYGRLPAPADGPAGPGPEALCFPEPQAQPDGGGLLAFSVQDGSPPGLDLDSSPVLQDWVT
ATDIRVVLTRPAMLGDTRDSETMVPYSYSATELQVGGRCKCNGHASRCLLDTQGHLICDC
RHGTEGPDCGRCKPFYCDRPWQRATAREAHACLACSCNGHARRCRFNMELYRLSGRRSGG
VCLNCRHNTAGRHCHYCREGFYRDPGRALSDRRACRACDCHPVGAAGKTCNQTTGQCPCK
DGVTGLTCNRCAPGFQQSRSPVAPCVKTPVPGPTEESNPVEPQNCDLHCKPARGSYRISL
KKFCRKDYAVQVAVGVRGELR
Download sequence
Identical sequences F6QJR4
ENSECAP00000015708 ENSECAP00000015708 9796.ENSECAP00000015708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]