SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QL33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QL33
Domain Number 1 Region: 125-352,396-442
Classification Level Classification E-value
Superfamily MFS general substrate transporter 7.98e-52
Family LacY-like proton/sugar symporter 0.043
Further Details:      
 
Domain Number 2 Region: 565-706
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.97e-19
Family Glycerol-3-phosphate transporter 0.043
Further Details:      
 
Domain Number 3 Region: 469-549
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000000144
Family Pentapeptide repeats 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6QL33
Sequence length 711
Comment (tr|F6QL33|F6QL33_XENTR) Synaptic vesicle glycoprotein 2B {ECO:0000313|Ensembl:ENSXETP00000016588} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=sv2b OC=Silurana.
Sequence
MDDGYRNNSHIYQGARDIAREVKRQTSNRAMDDYRYQDNTYGGYSPNDDYYSGDHANQDE
DAQSDATEGHDEDDEIYEGEYQGIPHPDDLRQHKASSIRDEFKDPADIIAERIEDEEQLA
YQYENIIQECGHGRFQWTLFVVLGLALMADGVEVFVVGFVLPSAEKDMCLSRSNKGMLGL
IVYLGMMLGAFVWGGLADKVGRKKCLIISLTINAAFSFVSSFVQGYGLFLFCRLISGFGI
GGSLPIVFAYFSEFLAREKRGEHLSWLCMFWMIGAVYAAAMAWSIIPHYGWGFSMGTHYH
FHSWRVFVVICVLPCIASIIALKFMPESPRFLLETGKHDEAWMILKNIHDTNMRAKGEPE
KVFTVSHIKTPKQPDEFIEIQSSTGTWFQRWFVRIMTVIKQIWENMLHCFSGQFRKNTIF
LAVVWFTMSLSYYGLTVWFPDTIRYLQDEDYASKVKRFTDENVKNFNFNFTLENQIHEDG
EYYNDRFYKMKLKYVTFKDSLFDECYFEDVTSTGSIFENCTIQNTVFYNTDLYQHKFIDC
NFINVTFSQPKEGCHIDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDKIGRIRMIAGS
MLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVVTVELYPTNKRATAFGILNG
LCKLAAIFGNSIFASFVGITKVIPILLASTALVGGGLISLRLPETRELVLM
Download sequence
Identical sequences F6QL33
ENSXETP00000016588 ENSXETP00000016588 XP_002933355.1.99540 XP_004912713.1.99540 gi|301607530|gb|XP_002933355|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]