SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QLZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QLZ6
Domain Number 1 Region: 49-496
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.2e-95
Family Integrin alpha N-terminal domain 0.000000000343
Further Details:      
 
Domain Number 2 Region: 796-1011
Classification Level Classification E-value
Superfamily Integrin domains 9.94e-52
Family Integrin domains 0.0000507
Further Details:      
 
Domain Number 3 Region: 498-654
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-43
Family Integrin domains 0.0000105
Further Details:      
 
Domain Number 4 Region: 655-789
Classification Level Classification E-value
Superfamily Integrin domains 5.49e-33
Family Integrin domains 0.0000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6QLZ6
Sequence length 1058
Comment (tr|F6QLZ6|F6QLZ6_HORSE) Integrin subunit alpha 5 {ECO:0000313|Ensembl:ENSECAP00000022617} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=ITGA5 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
GQWDSRSPWSPLHAVQLRWGPRRRPPLLPLLLPLLLLLLLPPPPRVGGFNLDAEAPAVLS
GPPGSFFGFSVEFYRPGTDGVSVLVGAPKANTSQPGVLQGGEVYLCPWGASPAPCTPIEF
DSKGSRILDSSLSSPEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPV
GTCYLSTDNFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQI
LSATQEQIAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGV
PKGNLTYGYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMER
TADGRPQEVGRVYVYLQHPAGMEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIG
APFGGETQQGVVFVFPGGPKGLGSKPSQVLLPLWAAGHSPDFFGSALRGGRDLDGNGYPD
LIVGSFGVDKAVVYRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASG
KHVPDSIGFTVELQLDWQKQKGGVRRALFLASRQAALTQTLLIENGAREDCREMKIYLRN
ESEFRDKLSPIHIALNFSLDPQAPVDSHGLQPVLHYQSKSRIEDKAQILLDCGEDNICVP
DLQLEVFGEQNHVYLGDKNSLNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNF
SSLSCDYFAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLN
NSQSDVVSFRLSVEAQAQVSLNGVSKPEAVLFPVSDWHPRDQPQEEADVGPAVHHVYELI
NLGPSSISRGVLELSCPQALEGQQLLYVTRITGLSNCTTSHPPNPQGLELDPEGSQSHQL
QRREAPGRSPASSGPQILKCPEAECFRLRCELGPLHRQESLSLQLHFRVWAKTFLQREHQ
PFSLQCEAVYEALKMPYRILPRQLPRKELQVATAVQWTKAEGSHGVPLWIIILAILIGLL
LLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
Download sequence
Identical sequences F6QLZ6
9796.ENSECAP00000022617 ENSECAP00000022617 ENSECAP00000022617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]