SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QMJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QMJ3
Domain Number 1 Region: 206-238
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000262
Family CCCH zinc finger 0.00024
Further Details:      
 
Domain Number 2 Region: 166-201
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000379
Family CCCH zinc finger 0.00021
Further Details:      
 
Weak hits

Sequence:  F6QMJ3
Domain Number - Region: 230-258
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.085
Family Obg GTP-binding protein N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6QMJ3
Sequence length 424
Comment (tr|F6QMJ3|F6QMJ3_MONDO) ZFP36 ring finger protein like 2 {ECO:0000313|Ensembl:ENSMODP00000000486} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ZFP36L2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
ASATLTGPRNMSTTLLSAFYDIDFFCKTEKSLTNLNLNSMLDKKAVGTPVTTSPSSSFTP
GFLRRHSTSNLQALTHPNPSPATVPGNCSPKFTGVNSCSSSGGSSSYSNLKEPSGGGGSA
GTTALLNKENKFRDRSFSENGDRSQHLMQLQQQQQQQKSGGGSQINSTRYKTELCRPFEE
SGTCKYGEKCQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRPS
PSGGAGGSGGDLRAFSPREALHLGFAAHPREPRPKLHHSLSFSGFSSAHHQHPGGLESPL
LESPTSCAAAAAALLYGAGGGGEDLLSPAPCAACANNAFAPFSGQELSNLITPLAIHTHN
FAPLRRLSESPVFDAPPSPPDSLSDRESYLSGSLSSGSLSGSESPSLDSGRRLPIFSRLS
ISDD
Download sequence
Identical sequences F6QMJ3
ENSMODP00000000486 13616.ENSMODP00000000486 ENSMODP00000000486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]