SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QMT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QMT3
Domain Number 1 Region: 52-178
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-67
Family RUNT domain 0.000000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6QMT3
Sequence length 453
Comment (tr|F6QMT3|F6QMT3_HORSE) Runt-related transcription factor {ECO:0000256|PIRNR:PIRNR009374} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=RUNX1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALIGKPRSVDRSMVEVLADHPG
ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA
TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYQRAIKITVDGPREPRRHR
QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQM
QDTRQIQPSPPWSYDQSYQYLGSITSPSVHPATPISPGRASGMTTLSAELSSRLSKTPLF
TGKGDFFFFKGMSNMCTPKSHIDRLHTLSENSWARVGLLSSTPSGGETFPTKIPEPPNPQ
ISYSLKAPCEYQGSPPLHLFVKASSGSYFFSMVGGRSPPRILPPCTNASTGSALLNPSLP
NQSDVVEAEGSHSNSPTNMAPAARLEEAVWRPY
Download sequence
Identical sequences F6QMT3
ENSECAP00000003260 ENSECAP00000003260 9796.ENSECAP00000003260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]