SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QNC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QNC9
Domain Number 1 Region: 393-498
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.89e-30
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6QNC9
Sequence length 1177
Comment (tr|F6QNC9|F6QNC9_XENTR) EH domain-binding protein 1 {ECO:0000313|Ensembl:ENSXETP00000028544} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=ehbp1 OC=Silurana.
Sequence
AHSWQPGIKNPYRGVVVWPVPENVEITVTLFKDPHAEEFEDKEWTFVIENESSSGRRKAL
ATSNINMKQYASPMPTQTDVKLKFKPLSKKVVSATLQFSLSCIFLREGKATKSDEDMQSL
ASLMSMKQADIGNLDDFEEDNEEDEENRVNQEEKTAKITEIVNQLNALSNLSEDQDACIK
QPHLPSAKSSTPCEELINKLNFLDEEERDLMNSSSNPFESSDVADFNPFGDPDAEENPSE
QAPSKSDDLFDDYNPFKEPEPAVYINPFDEPDTEQDQVLELSKDSPPQPAKRKNTRPVDM
SKYLYANKARQEEEDLDESNPFYEPKENLNVSQRTGVKEFDPEKKVKRKAPGPPMPSPKR
EEPARAPLAVPAGKDIAPSPKPSPLPSPTLGRQPNASQSLLAWCKEVTKSYRGVKITNFT
TSWRNGLAFCAILHHFRPDLIDYKSLNPQDIKENNKKAYDGFASIGISRLLEPSDMVLLA
IPDKLTVMTYLYQIRAHFSGQELNVVQIEENSSKSTYKVGDYETDTNSSIDQEKFYAELH
DLNQEAGPELEEAPSKLPDFLPHDGSALVHDNGILDKQSMASSAVESISAEMDFTCTRTR
SNLELQSPSRTFEYEKSSQCESSNEAYSEAQPLVTQRKLLKVDTTDLTDPCEVIEPRKEN
ISFGTTSGAHQQQSLADQPNPGSFTSTPQSGVDSIPKEKVYSQCYSVHSGDSNGKVGDFT
FKAPPLPQTAISSLIDSAKVSSNNSDQPSKSTEQRMLSRQEELKERARILLEQARKDAAL
KAGNKQRNNMSAPTRAKQLSDQQDEERRRQLRERARQLIAEARSGVKMSELPSYNEMSTE
KFKDRAKASGDEPDFNKALTNEESPDPTLVCGGGEPSNTDTDSTDLAGQNSHSVDVKLKR
LLEAQPQVANSLSNAAQKISPEATDRDFKNGAQDTRSERLQKAPDRFKNPVVFNKDSTVR
KTQLQSFSQYVESRPEMKRQRSMQEDTKRVNEEVVITETQKKPSEDEVLNKGFKDTSQYV
VGELAALENEQNQIDTRAALVEKRLRYLMDTGRNTEEEEVMMQEWFMLVNKKNALIRRMN
GLSLKEKEHDLERRFELLNRELRAMLAIEDWQKTEAQKRREQLLLDELVILVNKRDALVR
DLDAQEKQAEEEDEHLERTLEQNKGKMAKKEEKCAIQ
Download sequence
Identical sequences F6QNC9
ENSXETP00000028544 ENSXETP00000028544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]