SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QPI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QPI3
Domain Number 1 Region: 196-255
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000694
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6QPI3
Sequence length 425
Comment (tr|F6QPI3|F6QPI3_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000033650} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAASIICQEHGRISGQAKIDVLLVGDVTVGYLADMVQKLFSNTAEVAITISDLKEAAALL
DDWIFSMIFLKMPSSLSAEELEAIQLIRFGKKKNTHSLFVFIIPENFKGCISGHAGDMTL
TEPLTMEKLSIVVKYWNTCLSNTVKIENATGPEEPGLPLQRSYSEHLGYFPTDLSACPES
LGNGNGLELNASLSEPERSRKTSLLHSSKEKLRRERIKYCCEQLRVLLPYVKGRKNDTAS
VLEATVEYVKYIRAKIPPAVMAQITEALQSNNRFCKKQQTPLQLSLLGTVMAQWENSVPS
TYSPERGLQFLPNTCWNVCSTPGAVGSLDEAVRGPLSSTSENAIGDQYKTQIPNAAPSLN
SFHTVRYYSNVTPSYDETAVTNQNISIHLPSAVPPVSNLLPQHCTSGLGQTCTTHPTCLQ
QFWAY
Download sequence
Identical sequences F6QPI3
ENSCJAP00000033650 ENSCJAP00000033643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]