SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QS14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QS14
Domain Number 1 Region: 53-85,163-219,252-382
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.22e-34
Family PAPS sulfotransferase 0.017
Further Details:      
 
Weak hits

Sequence:  F6QS14
Domain Number - Region: 130-179
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0961
Family TB module/8-cys domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6QS14
Sequence length 403
Comment (tr|F6QS14|F6QS14_HORSE) Sulfotransferase {ECO:0000256|RuleBase:RU361155} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=CHST2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
PEVAAAAHAGAAAAGLCGTQPPPGNGTRGTGVGGDKASLVYVFTTCALARPFFGELFTRT
PRVFFLYEPVWHVWQKLYPGDAVSLQGAARDMLSALYRCDLSVFQLYSPAGSGGRNLTTL
GIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCKKCPPQRLARFEEECRKYRTLVIKGVR
VFDVAVLAPLLRDPALDLKVIHLVRDPRAVASSRIRSRHGLIRESLQVVRSRDPRAHRMP
FLEAAGHKLGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVRYED
LVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTAL
TFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL
Download sequence
Identical sequences F6QS14
ENSECAP00000022892 ENSECAP00000000670 9796.ENSECAP00000022892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]