SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QWS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QWS0
Domain Number 1 Region: 98-172
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 6.28e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6QWS0
Sequence length 243
Comment (tr|F6QWS0|F6QWS0_CALJA) Transcription factor AP-4 {ECO:0000313|Ensembl:ENSCJAP00000036748} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TFAP4 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
CTLQEGQLSLFPPGPGWVLSRLSYPQPAYSVPGCPRSAPPSPSGGGLASFAAGAGCRFYW
DPLEMNDEEGALAKPVPVLSGSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGF
QSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRR
RAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKL
KVI
Download sequence
Identical sequences F6QWS0
ENSCJAP00000036748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]