SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QXI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QXI9
Domain Number 1 Region: 19-109
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 2.93e-28
Family ECR1 N-terminal domain-like 0.00000401
Further Details:      
 
Domain Number 2 Region: 198-275
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.77e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000732
Further Details:      
 
Domain Number 3 Region: 110-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.69e-20
Family Cold shock DNA-binding domain-like 0.00000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6QXI9
Sequence length 277
Comment (tr|F6QXI9|F6QXI9_CALJA) Exosome component 3 {ECO:0000313|Ensembl:ENSCJAP00000019553} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=EXOSC3 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAEGVSVVAESLAGGGARVARSVLGQVVLPGEELLLPEQEDAEGPGGAGERPLSLNAGAC
SRVRVICGPGLRRCGDRLLVTKCGRLRHKEPGGGGGGGGGVYWVDSQQKRYVPVKGDHVI
GIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEM
VCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIW
VKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Download sequence
Identical sequences F6QXI9
ENSCJAP00000019534 ENSCJAP00000019553 XP_002743149.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]