SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6R1E1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6R1E1
Domain Number 1 Region: 760-973
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.11e-59
Family DBL homology domain (DH-domain) 0.00000000299
Further Details:      
 
Domain Number 2 Region: 958-1112
Classification Level Classification E-value
Superfamily PH domain-like 1.61e-47
Family Pleckstrin-homology domain (PH domain) 0.0000000616
Further Details:      
 
Domain Number 3 Region: 676-775
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-20
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6R1E1
Sequence length 1181
Comment (tr|F6R1E1|F6R1E1_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000026066} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ARHGEF9 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MEPFDNCPEAPSEHAPNGYAGLILSQDSTEIEAAGAMELSNLENSAAVDGHSKEETSWLK
KKAKVNKIWNFVSRKKGPLGQGKRPQSMIVLSSPTRPSETKPKITFMDRMKSIKRLRSSS
GLGKGATERSFKAQPSLNCPGDQEEGIWQKDLYRVRRPLDNQRLFRHSYAGHTEGLEDCF
GDVEFNIPVPELEASDGKGSRDLDIQTNEEDQEGIGPLEVEDPQNDNENVASQVLRASQD
CRKRCQTLPQENRRRRTSDVWSYLKGISLANRDNSKTTEAEPESNFRGMENAARNSTLFL
GFESGHEESSRQMRRGSSTNKATHFGGVFRFFTNMAEAARKWRGSSRTPFPEEPKSSSKR
HPLQLLEVPGENRVPASFLMRLSLQSPDIWDHSHIQTSTWRNDRLQNHNTESIHVTYSLE
LNSKSQSLGQVICSQPDISMLSLPTLQGEGQISPAPLAQPPPRGLSEAQPPSPGFPEQLE
TTGGCLGEKEHRGGRCSQLNEEAAGAEQSTSELTSKKRPTYIKEEEEKEDEEEGEEESGS
IQVEEQDSFELLDETSHSKYSPKCHPFQMSLCTIVSLTEINSRKASCHPSHPSPSPPPFK
VLDRCRSLPLSQSTPMGLDQVGWRRRLLLNPASTALNSKTLESRRESQRKKKASKPRQPG
AEQVFINKLISGGSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEG
WFPASFVRLWVNQEDGVEEGTSEVQNGHLDPNADCLCLGRSLQNRDQMRANVINEIMSTE
RHYIKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNEDP
HLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDGRYQHFFEACRLLQQMIDIAI
DGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENID
KIAQWQASVLDWEGEDILDRSSELIYTGEMSWIYQPYGRSQQRVFFLFDHQLVLCKKDLI
RRDILYYKGRIDMDKYEVFDIEDGRDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKLR
WLRAFREERKMVQEDEKIGFEISENQKRQAAMTVRKVSKQKGANYSRAVPPAYPPPQDPV
SQGQYLVTDGITQSQVFEFSEPKRSQSPFWQNFSRLTPFKK
Download sequence
Identical sequences F6R1E1
XP_016282136.1.35504 ENSMODP00000026066 ENSMODP00000026066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]