SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6R2P3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6R2P3
Domain Number - Region: 262-282
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0259
Family CCCH zinc finger 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6R2P3
Sequence length 318
Comment (tr|F6R2P3|F6R2P3_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000021006} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MEPHTEKLEFFRKLGYGQDDVVRVLAKLGQGALVNDILQELIQMGSRPQTEESCGESPAP
KLVSRGCGGSMDSSRQLLGMDPDEELEDPANHLRPIVIDGSNVAMSHGNKETFSCRGIRL
AVDWFRERGHNYIKVFVPSWRKEPPRSETPISEQHILEEMEKQAVLVYTPSRKVNGKRVV
CYDDRYIVKVAYEKDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDKFMPPDDPLG
RHGPTLSNFLSKKPKLPQPSWQHCPYGRKCTYGVKCKFYHPERLHQIQLSVADELRAKTR
TLPGSKGPASCTLGRSPP
Download sequence
Identical sequences F6R2P3
ENSMODP00000021006 13616.ENSMODP00000021006 ENSMODP00000021006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]