SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6R7A2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6R7A2
Domain Number 1 Region: 394-655
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.57e-56
Family Nuclear receptor ligand-binding domain 0.0000000203
Further Details:      
 
Domain Number 2 Region: 322-399
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.62e-28
Family Nuclear receptor 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6R7A2
Sequence length 657
Comment (tr|F6R7A2|F6R7A2_MOUSE) Nuclear receptor subfamily 4 group A member 3 {ECO:0000313|Ensembl:ENSMUSP00000121455} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Nr4a3 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
XRYPPGPQHLFSRQDLIPYTHDSISFGNVDMPCVQAQYSPSPPGSTYATQTYGSEYTTEI
MNPDYTKLTMDLGSTGIMATATTSLPSFSTFMEGYPSSCELKPSCLYQMPPSGPRPLIKM
EEGREHGYHHHHHHHHHHHHHQQQQPSIPPPSGPEDEVLPSTSMYFKQSPPSTPTTPGFP
PQAGALWDDELPSAPGCIAPGPLLDPQMKAVPPMAAAARFPIFFKPSPPHPPAPSPAGGH
HLGYDPTAAAALSLPLGAAAAAGSQAAALEGHPYGLPLAKRTATLTFPPLGLTASPTASS
LLGESPSLPSPPNRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKNCPVDKRRRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQP
SPPSPPICMMNALVRALTDATPRDLDYSRYCPTDQATAGTDAEHVQQFYNLLTASIDVSR
SWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRG
FGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCTKITSSLKDH
QRKGQALEPSEPKVLRALVELRKICTQGLQRIFYLKLEDLVPPPSVIDKLFLDTLPF
Download sequence
Identical sequences F6R7A2
ENSMUSP00000121455 ENSMUSP00000121455 10090.ENSMUSP00000121455 ENSMUSP00000121455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]