SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6R8T5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6R8T5
Domain Number 1 Region: 11-147
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.44e-28
Family Hormone receptor domain 0.00025
Further Details:      
 
Domain Number 2 Region: 138-410
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000449
Family Rhodopsin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6R8T5
Sequence length 451
Comment (tr|F6R8T5|F6R8T5_MONDO) Secretin receptor {ECO:0000313|Ensembl:ENSMODP00000000454} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=SCTR OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MATTMQTSNLWLIIFSWAALTVGAPPLLCDVLQMLQKEEEQCLQELSKEWKNNSENEQPI
SGCPGVWDNMSCWPSASAGQTVKAECPKFLQMLTGKNGSVFRNCTQDGWSDTFPRTDAAC
GYDVNDTTNEKRRSYLLKLKVMYTVGYSTSLVMLLVALGILIAFRKLHCTRNYIHMHLFV
SFILRALSNFIKDAVLFSNDVAHCDDHMVGCKTVMVFFQYCIMSNYSWLLVEGLYLHTLL
VISFFSEKKVLQCFIIFGWGSPAVFATTWAITRHFLENNGCWDINVNPGIWWIIRGPTLI
SVLVNFILFVNILRILMKKLRTSKMRGNDMNHYKRLAKSTLLLIPLFGVHYIIFAFTPED
AGSPTVEIQMFFELALGSFQGLVVAILYCFLNGEVQLEIQRKWRQRYLNNWFWMRPALSS
SFSNGASGPTQMTKASPLEQGRGTAWKASVI
Download sequence
Identical sequences F6R8T5
XP_007494123.1.35504 ENSMODP00000000454 ENSMODP00000000454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]