SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6RAD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6RAD7
Domain Number 1 Region: 519-705
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.16e-25
Family Pectin methylesterase 0.072
Further Details:      
 
Domain Number 2 Region: 661-823
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.39e-24
Family Pectate lyase-like 0.062
Further Details:      
 
Domain Number 3 Region: 266-488
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.98e-22
Family Pectate transeliminase 0.093
Further Details:      
 
Domain Number 4 Region: 155-238
Classification Level Classification E-value
Superfamily F-box domain 5.23e-21
Family F-box domain 0.0021
Further Details:      
 
Weak hits

Sequence:  F6RAD7
Domain Number - Region: 54-63
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000628
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6RAD7
Sequence length 924
Comment (tr|F6RAD7|F6RAD7_HORSE) F-box protein 11 {ECO:0000313|Ensembl:ENSECAP00000008528} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=FBXO11 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MNSVRAANRRPRRVSRPRPVQQQQQQPPQQPPPQPPQQQPPQQQPPPPPQQQQPPPPPPP
PPPLPQERNNAGERDDDVPADMVAEESGPGAQNSPYQLRRKTLLPKRTACPTKSSMEGAS
TSNTENFGHRAKRARVSGKSQDLSAAPAEQYLQEKLPDEVVLKIFSYLLEQDLCRAACVC
KRFSELANDPILWKRLYMEVFEYTRPMMHPEPGKFYQINPEEYEHPNPWKESFQQLYKGA
HVKPGFAEHFYSNPARYKGRENMLYYDTIEDALGGVQEAHFDGLIFVHSGIYTDEWIYIE
SPITMIGAAPGKVADKVIIENTRDSTFVFMEGSEDAYVGYMTIRFNPDDKSAQHHNAHHC
LEITVNCSPIIDHCIIRSTCTVGSAVCVSGQGACPTIKHCNISDCENVGLYITDHAQGIY
EDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFE
VKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSI
FNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKG
QGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMY
SGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIEDNEIFDNAMAGVWIKTDSNPTLR
RNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFDGFAAGIEI
TNHATATLEGNQIFNNRFGGLFLASGVNVTMKDNKIMNNQDAIEKAVSRGQCLYKISSYT
SYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAG
EPTHDTDTLYDSAPPIESNTLQHN
Download sequence
Identical sequences F6RAD7
9796.ENSECAP00000008528 ENSECAP00000008528 ENSECAP00000008528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]