SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6RB67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6RB67
Domain Number 1 Region: 276-428
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.45e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000661
Further Details:      
 
Domain Number 2 Region: 431-596
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.92e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000164
Further Details:      
 
Domain Number 3 Region: 148-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.0000196
Further Details:      
 
Domain Number 4 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-33
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 642-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-27
Family MAM domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6RB67
Sequence length 931
Comment (tr|F6RB67|F6RB67_HORSE) Neuropilin {ECO:0000256|PIRNR:PIRNR036960} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=NRP2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MDMFPLSWVFLALCFSGHEVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSVL
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPKVEIVLQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRS
STGILSLTFHTDMAVAKDGFSARYYLVHQEPLESFQCNVPLGMESGRIANEQISASSTYS
DGRWTPQQSRLHGDDNGWTPNLDSSKEYLQVDLRFLTMLTAIATQGAVSRETQNGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNRLHTPLLTRFVRIRPQTWHSGIAL
RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTREYLWTPSAARLVSSRSGWFPRIPQ
AQPGEEWLQVDLGAPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYVQD
PRTQQPKLFEGNMHYDTPDLRRFDPVPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSRPT
VETLGPTVKSEETTTPYPIDEEATECGENCSFEDDKDLQLPSGFNCNFDFPEEPCGWMYD
HAKWLRSAWTSSTSPSDRTFPDDRNFLRLQSDGRREGQYGRLISPPLHLPRSPVCMEFQY
QATGGRGLVLQVVREASRESKLLWVIREDQGDEWKHGRIILPSYDMEYQIVFEGVIGKGR
SGEIAIDDIRISTDVPLENCMEPISAFAGEHFKVDIPEIHGREGYEDEIDDEYEVDWGNS
SAPTSGSGAPSANREKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSR
SCTTLENYNFELYDGLKHKVKMNHQKCCSEA
Download sequence
Identical sequences F6RB67
ENSECAP00000015439 9796.ENSECAP00000015439 ENSECAP00000015439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]