SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6RF62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6RF62
Domain Number 1 Region: 47-191
Classification Level Classification E-value
Superfamily EF-hand 1.97e-31
Family Calmodulin-like 0.00000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6RF62
Sequence length 193
Comment (tr|F6RF62|F6RF62_BOVIN) Myosin light chain 4 {ECO:0000313|Ensembl:ENSBTAP00000050283} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=MYL4 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MPPKKPEPKKEVAKPATAPAASPAPPPEPLKEPAFDPKSVKVSYTSTYVTEFKEAFSLFD
RTPTGELKIAYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNSKMLDFETFLPILQHIS
RNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMSEAEVEQLLAGQEDANGC
INYEAFVKHIMSG
Download sequence
Identical sequences F6RF62
ENSBTAP00000050283 ENSBTAP00000050283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]