SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6RG52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6RG52
Domain Number 1 Region: 35-134
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 177-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000335
Family EGF-type module 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6RG52
Sequence length 643
Comment (tr|F6RG52|F6RG52_HORSE) Neuregulin 1 {ECO:0000313|Ensembl:ENSECAP00000018879} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=NRG1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MSERKEGRGKGKGKKERGSGRKPAPAEGGPSPALPPRLKEMKSQESVAGSKLVLRCETSS
EYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASVTDSGEYMCKVISKLGND
SASANITIVDSNEIFTGMPASTETAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLVK
CAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
ELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMVNIANGP
HHPNPPPENVQLVNQYVSKNVISSEHIVEREVETSFSTSHYTSTAHHSTTVTQTPSHSWS
NGHTESIISESHSVIMMSSVENSRHSSPTGGPRGRLNGMGGPRECNSFLRHARETPDSYR
DSPHSERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSTTVSMPSMAVSPFVEEER
PLLLVTPPRLREKYDHHPQQFNSFHHNPAHESNSLPPSPLRIVEDEEYETTQEYEPAQEP
VKKLTNSRRAKRTKPNGHIANRLEMDSNTSAESSNSESETEDERVGEDTPFLGIQNPLAA
SVEAAPAFRLADSRTNPAGRFSTQEELQARLSSVIANQDPIAV
Download sequence
Identical sequences F6RG52
9796.ENSECAP00000018879 XP_005606393.1.31192 ENSECAP00000018879 ENSECAP00000018879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]