SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6RGE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6RGE3
Domain Number 1 Region: 268-558
Classification Level Classification E-value
Superfamily Kelch motif 2.75e-57
Family Kelch motif 0.00016
Further Details:      
 
Domain Number 2 Region: 10-128
Classification Level Classification E-value
Superfamily POZ domain 3.88e-33
Family BTB/POZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6RGE3
Sequence length 578
Comment (tr|F6RGE3|F6RGE3_CALJA) Kelch like family member 30 {ECO:0000313|Ensembl:ENSCJAP00000000787} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KLHL30 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MVRNVDDLDFHLPSHAQNMLEGLQRLRSQPKLADVTLLVGGRELPCHRGLLALSSPYFHA
MFAGDFAESFSARVELRDVEPAVVGQLVDFVYTGRLTITQGNVEALTRTAARLHFPSVQK
VCGRYLQQQLDAANCLGICEFGEQQGLLGVAAKAWAFLRENFEAVAHEDEFLQLPRDRLA
TCLASDLLQVQPERSRLEALLRWVRHDPQARATHLPALLSLVRLDAVPRPCVQQLLATEP
LIQESEACRAALSQGHDGAPPTLQQKLEEVLVVVGGRALEEDEAGEELTPHLGNFAFYNS
KAKRWMALPDFPDYHKWGFSLAALNNAIYVTGGSRGTKTDTWSTTQAWCFPLKEAAWKPV
APMLKARTNHASAALNGEIYVIGGTTLDVVEVESYDPYTDSWTPVSPALKYVSNFSAAGC
RGRLYLVGSSACKYNALALQCYSPVTDAWSVIASPFLPKYLSSPRCAALHGALYLIGDNT
KKVYVYDPGANLWQKVQSQHSLHENGALVPLGDALYVTGGRWQGMEGDYHVEMEAYDTVQ
DTWTRHGALPRLWLYHGASAVFLDVSKWTQPFRPAQEH
Download sequence
Identical sequences F6RGE3
ENSCJAP00000000787 XP_002750003.1.60252 XP_017829344.1.60252 ENSCJAP00000000781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]