SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6RGM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6RGM1
Domain Number - Region: 108-136
Classification Level Classification E-value
Superfamily Elafin-like 0.0575
Family Elafin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6RGM1
Sequence length 381
Comment (tr|F6RGM1|F6RGM1_HORSE) p2X purinoceptor {ECO:0000256|RuleBase:RU000681} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=LOC100051842 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MGSSGAWTGWGLLDYKTEKYVMTKNWRVGALQRLLQLGVLVYMVGWALLAKKGYQEQDLD
PQVSVITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTNFLVMPEQVQGRCPEA
PSIPLANCWSDEDCPEGETGTHSHGIKTGQCVIFNGTHRTCEIWGWCPVESDTVPVKPLL
VQAENFTLFIKNTVTFSKFNFSKSNALETWDATYFKRCRYDPRFSPYCPVFRIGDLVAMA
GGVFEDLALLGGAVGIHVHWDCDLDAVGSDCRPHYSFQLQERSYNFRTATHWREASGLEA
RSLLKLYGIRFDILVTGRAGKFGLIPTTITLGTGAAWLGVITFCCDLLLLYVDGEAHFYW
STKYEEAKAPKRTANPEQTGG
Download sequence
Identical sequences F6RGM1
ENSECAP00000006892 ENSECAP00000006892 9796.ENSECAP00000006892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]