SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6RK26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6RK26
Domain Number 1 Region: 32-123
Classification Level Classification E-value
Superfamily Immunoglobulin 2.36e-22
Family V set domains (antibody variable domain-like) 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6RK26
Sequence length 126
Comment (tr|F6RK26|F6RK26_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000038238} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MIHAWLVPHMGIKFLHCISIFLLGAGLTDAEVTQTPKQLVTEIRQQVNLTCHPISGHTGL
YWYQQVTGNGIELLVYLQNNKILDDTQFSKDRFSVIWPKSSPSILTIKTTELKDSAVYLC
ASSPTT
Download sequence
Identical sequences F6RK26
ENSMODP00000038238 ENSMODP00000038238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]