SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6RKU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6RKU0
Domain Number 1 Region: 216-281
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000158
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000219
Further Details:      
 
Domain Number 2 Region: 283-328
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000076
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Weak hits

Sequence:  F6RKU0
Domain Number - Region: 61-116
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0728
Family Chromo barrel domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6RKU0
Sequence length 634
Comment (tr|F6RKU0|F6RKU0_CALJA) Fragile X mental retardation 1 {ECO:0000313|Ensembl:ENSCJAP00000007346} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=FMR1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPERQIPFHDVRFPPPVGYNKDIN
ESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACDATYNEIVTIERLRSVNPNKP
ATKDTFHKIKLDVPEDLRQMCAKESAHKDFKKAVGAFSVTYDPENYQLVILSISEVTSKR
AHMLIDMHFRSLRTKLSLILRNEEASKQLESSRQLASRFHEQFIVREDLMGLAIGTHGAN
IQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGKVIGKN
GKLIQEIVDKSGVVRVRIEAENEKNVPQEEEIIPPNSLPSNNSRIGPNAPEEKKHLDAKN
NLSQMSQLVIWVFSLVLVVSSVVAGESQKPELKAWQGMVPFVFVGTKDSIANATVLLDYH
LNYLKEVDQLRLERLQIDEQLRQIGASSRPPPNRTDKEKGYVTDDGQGMGRGSRPYRNRG
HGRRGPGYTSGTNSEASNASETESDHRDELSDWSLAPTEEERESFLRRGDGRRHSMGGLD
RGCGNKELPNVFIGNDDHSRTDNRPRNPREAKGRTTDGSLQIRVDCNNERSVHTKTLQNT
SSEGNRLRTGKDRNQKKEKPDSVDGQQPLVNGVP
Download sequence
Identical sequences F6RKU0
ENSCJAP00000007346 ENSCJAP00000007345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]