SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6RM94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6RM94
Domain Number 1 Region: 1-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.6e-77
Family BAR domain 0.00000000174
Further Details:      
 
Domain Number 2 Region: 270-333
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-23
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6RM94
Sequence length 338
Comment (tr|F6RM94|F6RM94_HORSE) SH3 domain containing GRB2 like 2, endophilin A1 {ECO:0000313|Ensembl:ENSECAP00000008025} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=SH3GL2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
QKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTM
SKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDME
VKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESK
EIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRRE
YQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPAGAPMDQPCCRALYDFEPENEGELGFKEG
DIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH
Download sequence
Identical sequences F6RM94
ENSECAP00000008025 9796.ENSECAP00000008025 ENSECAP00000008025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]