SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6RQ92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6RQ92
Domain Number - Region: 64-110
Classification Level Classification E-value
Superfamily E set domains 0.0252
Family RhoGDI-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6RQ92
Sequence length 1165
Comment (tr|F6RQ92|F6RQ92_HORSE) WASH complex subunit 5 {ECO:0000313|Ensembl:ENSECAP00000022044} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=WASHC5 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
VILTMLDFLADNNLCGQAILRIVSCGNAIIAELLRLSEFIPAVFRLKDRADQQKYGDIIF
DFSYFKGPELWESKLEAKPELQDLDEEFRENNIEIVTRFYLAFQSVHKYIVDLNRYLDDL
NEGVYIQHTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIDGEVRERMLVSYYRYSAAR
SSADSNMDDICKLLRSTGYSSQPGAKRPPNYPESYFQRVPINESFINMVIGRLRSDDIYN
QVSAYPLPEHRSTALANQAAMLYVILYFAPSILHTHQAKMREIVDKYFPDNWATVISIYM
GITVNLADAWEPYKAAKTALNNTLDLSNVREQASRYATVSERMRAQVQQFLKEGYLREEM
VLDNIPKLLNCLRDCNVSIRWLMLHTADSACDPNNKRLRQIKDQILTDSRYNPKILFQLL
LDTAQFEFILKEMFKHMLSEKQAKWEHYKKEGSERMTELADVFSGVKPLTRVEKNENLQA
WFREISKQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQM
IRTINIKEEVLITMQIVGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALD
LPLLRINQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPT
RLDKDKLRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKEL
VKRVAFALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEV
SRIINYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFTPVDESVTFIGRLCREILRITDP
KMTCHIDQLNTWYDMKTHQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSM
FQKIILRDRTVQDTLKTLMNAVSPLKSIVANSNKIYFSAIAKTQKIWTAYLEAIMKVGQM
QILRQQIANELNYSCRFDSKHLAAALENLNKALLADIEAHYQDPSLPYPKEDNTLLYEIT
AYLEAAGIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNLGMVCRKPADPVDWP
PLVLGLLTLLKQFHSRYTEQFLALIGQFIRSTVEQCTSQKIPEMPADVVGALLFLEDYVR
YTKLPRRVAEAHVPNFIFDEFRTVL
Download sequence
Identical sequences F6RQ92
ENSECAP00000022044 9796.ENSECAP00000022044 ENSECAP00000022044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]