SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6RUK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6RUK8
Domain Number 1 Region: 154-220
Classification Level Classification E-value
Superfamily Homeodomain-like 1.37e-23
Family Homeodomain 0.001
Further Details:      
 
Weak hits

Sequence:  F6RUK8
Domain Number - Region: 13-63
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00628
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6RUK8
Sequence length 316
Comment (tr|F6RUK8|F6RUK8_HORSE) BarH like homeobox 2 {ECO:0000313|Ensembl:ENSECAP00000008269} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=BARHL2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MESPEPHLVADGPQHHHHLHHSQQPPPAAAPTQSLQPSPQQQPPPPPPPQQPPAQQLGSA
ASAPRTSTSSFLIKDILGDSKPLAACAPYSTSVSSPHHTPKQESNAAHESFRPKLEQEDS
KSKLDKREDSQSDIKCHGTKEEGDREITSSRESPPVRAKKPRKARTAFSDHQLNQLERSF
ERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMF
PSPYFYHPSLLGSMDSTTAAAAAAAMYSSMYRTPPAPHPQLQRPLVPRVLIHGLGPGGQP
ALNPLSNPIPGTPHPR
Download sequence
Identical sequences F6RUK8
ENSECAP00000008269 9796.ENSECAP00000008269 ENSECAP00000008269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]