SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6RVZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6RVZ5
Domain Number - Region: 231-297
Classification Level Classification E-value
Superfamily Immunoglobulin 0.008
Family V set domains (antibody variable domain-like) 0.056
Further Details:      
 
Domain Number - Region: 152-190
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00981
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number - Region: 90-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.01
Family V set domains (antibody variable domain-like) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6RVZ5
Sequence length 357
Comment (tr|F6RVZ5|F6RVZ5_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000031588} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
GTDGGGDPGPANSLRCPQPSGWIPEHQRASKSSSKGRGSAPRRRGFHPRGSRGAPVLPWG
PGAAGAIGCWCASGAAAPRKSQVIPEVSGDLHLQHTSTDQSGTYHCQDEAGNTRVVYNVD
FQDGTKLYVSHSELNQLPLKNQTVGNNNQWTLFTQWGPWQACNRCGIQGERKRVGLCYAK
RSGQSELPCGLANLSPQGYHRGPELQIEGCFIRCGHSAADSTMVLYGTYQLEEEENSTVW
LSCPFATIYRPVSWESDNTSPTWRQQLSLNKTGLVLDLPSGGSRLQVSISDTYRCYVARK
LVGRFDPAWTHDPPRTLARSEIVRIYSVIEAVMVMAVLLLILLSFIQMCRTKLNTNI
Download sequence
Identical sequences F6RVZ5
ENSMODP00000031588 ENSMODP00000031588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]