SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6RZ43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6RZ43
Domain Number - Region: 366-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00116
Family EGF-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6RZ43
Sequence length 481
Comment (tr|F6RZ43|F6RZ43_MACMU) N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase {ECO:0000313|Ensembl:ENSMMUP00000032661} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=NAGPA OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAASTGRWLLLRLALLGFLWEASGGLDSGASRDDDLLLPYPRARARLPRDCTRVRAGRRE
HESWPPPPATPGAGGLAVRTFVSHFRDRAVTGHLTRAVAPLLTFSVLEPGGPGGCAARRR
ATVEETARAAGCRVAQNGGFFRMNTGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVI
GYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISAR
TAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTLA
SYPSDHCQDNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGHCQCTGHFWRGPSCGEL
DCGPSNCSQHGQCTETGCRCDAGWTGSNCSEVKQCLQPSEATLRAGELSFFTRTTWLALT
LALAFLLLLSLAANLSLLLSRAERNRRLRGDYAYHPLQEMNGELLAVEKEQPGGAHNPFK
D
Download sequence
Identical sequences F6RZ43
ENSMMUP00000032661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]