SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6RZS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6RZS2
Domain Number 1 Region: 1005-1221
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-37
Family DBL homology domain (DH-domain) 0.002
Further Details:      
 
Domain Number 2 Region: 1376-1575
Classification Level Classification E-value
Superfamily PH domain-like 4.79e-33
Family Pleckstrin-homology domain (PH domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 1207-1322
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-21
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6RZS2
Sequence length 1577
Comment (tr|F6RZS2|F6RZS2_MONDO) FYVE, RhoGEF and PH domain containing 5 {ECO:0000313|Ensembl:ENSMODP00000008846} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=FGD5 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MNNAESPKPPLAPKPKTTGHFTPAVSKFPPSSRSDILHSPNSMSRGPKPPIAPKPKLATT
NRGKTRVYMNNTFNKFSNGKLICSDGELYEGNQSNPECSESEADDDYILVTETQLTKGSF
KILEQEPCCAENEKPASLSATREEETEAEDPSSSNCSSSFEAKVEETEEDSLSSTDRVDD
SNELALGGDYKRTDSSFQGSPGETETQDPMYENTGEDIDYENDPDEKDKLFVRKERDSLI
ENQYGYSLEEEREDCKDIVLTHIASEEPEASGEQPGDPEESLDVGDANSEGYADAEPSSS
DCYGVSNIPPAGGEDEAKNEFNEELEPCDELSKTGLAVEDSEITDWEKEDLVDNGDQDAE
TKDDQEEEAAVQGMGEDIQNGEDMLKDEVADESCQIIPFESEGGDELLDSLSGNSFAFLP
TESTSFCSDSYYPLSESVKESEMGAEMDLGSASMGFLVTGSRIETTLKETHEIIGEADDV
SGDDVNLPGQMQDNEQAPLTGLVNNQSGSPDDEAFEVPAVVIVPEETLDDETVDDSLIDP
YVMGVSLIHRDENSFPGGRGHSETKGEEGTQNNCSTKEEINADADSGLITMDRKNIVTRA
RSHSGKVPGYVPETVPEETGPETDLLSMDSRHTVQEGNKTWLPMEGKPLEINRALPAKPR
SFILYPRSFSVEGRDLPVSLYRELEESILDEGRIKRKEDNLSLPCVIGSSGSFSQRSHLS
SSGMSTPSSVVDIPPPFDLACITKKPITKSSPSLLIDNDSPDKYTKKKKSSFKRFLALTF
KKRTENKVHVDVNVSSSRSSSESSYHGPSRVLEIDRRSLSNSPQLKSRSGKLRASDSPSS
IIFYRDIKRKGAPFSRSVSRVESFEDRSRPPFLPLPLTKPRSISFPNADTSDYENIPAMN
SDYENIQIPPRRPTRAGTFTKLFEDPSRALSTANENDGYVDMSSFNAFESKQQTTDQETE
SAYTEPYKVCPISAVPTEDVTSDEEQKSSEEEESSQREPGLTHKKEGQSRAYVIAQELLS
SEKAYAQVLQHLMLDFHEAILKALSEETEDNEESLARGELRQGLSELPAIYELHQEILSE
MEERILNWEEQPKVADIFLTQAPKFDHHVAYIMKFDKNLTLLNGNCIKSSQLTTTLREFE
NPQSGGQGVKHQLLKVVEHIFQYQVLLTDYLNNLCPDSAEYENTQDALALISKVTDRAND
SMEQGENLQKLVHIEHSVRGQNNLLQPGREFLTEGTLMKVTGKSRHPRHLFLMSDVLLYT
FPQKDGKYRLKNTLTVSSMRVSRPVMEKVPYALKIESAETCLMLSASSCSERDEWYSCLI
RTLPEGYQMHTLAAFHNSVEIRERLGICLGERPPTLVPVSHVMMCMNCGCDFSLTLRRHH
CHACGKIVCRNCSRNKYPLKYLKDRLAKVCDGCYAELKKRGGDIPGLLKERPVSMSFPMS
SSRFSSGAFSSVFHSINPSAFKKQKKIPSALTEVAASAEGSAISGYLSRRKKGKRHWKTL
WFVIKGKVLYTYMASEDKVATESIPLLGFTIAPEEGNRDLGLVFHLYHKQTLFYSFKAED
TNSAQRWVEAMKDATVL
Download sequence
Identical sequences F6RZS2
ENSMODP00000008846 XP_007500330.1.35504 ENSMODP00000008846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]