SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6S0V2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6S0V2
Domain Number 1 Region: 298-381
Classification Level Classification E-value
Superfamily Immunoglobulin 2.71e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 115-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000596
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 201-276
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000406
Family I set domains 0.015
Further Details:      
 
Weak hits

Sequence:  F6S0V2
Domain Number - Region: 35-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00424
Family V set domains (antibody variable domain-like) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6S0V2
Sequence length 426
Comment (tr|F6S0V2|F6S0V2_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000012003} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MERPSEASQSRGSTWKGLLIITASILSCWSQPTSAQDLTVVPDPVYGRVGDTVTLNVLEY
SGRALGYNWYYKSSAQDPDLTLLIQHNVQDGKLIPEDTRQKILTGGAQLTVYARPPKPTI
ISSNMAPVENKDTVSLACQAEGQILTYRWFMNESAPTGERIQLSLDNKTLTIKNITREDK
GPYVCEIRIPVSMSDPFTVNVTYGPDTPMIVHTVDRFSIGAYIEFICSAESNPPAQFTWF
QNGQKLSNSATLSTTVSLNHTGTYTCHASNSYTGLNSSKDKNIAIYEKLMKPNITINSTG
IIMENETVVLMCNTENKDLPDIWWYFQNKKLILNDRMTLSQNNQTLTIMSMKREDNGAYQ
CKVWNPVFANISDLFNLAVIYKKALSLSGGPIAGIVIGVLAGVALIGALIYNLFIKISIE
EYSITF
Download sequence
Identical sequences F6S0V2
ENSMODP00000012003 ENSMODP00000012003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]