SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6S429 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6S429
Domain Number 1 Region: 153-214
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 385-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 441-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 803-859
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 690-747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 844-896
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 747-803
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.51e-20
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 349-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000036
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 653-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000373
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6S429
Sequence length 965
Comment (tr|F6S429|F6S429_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000019283} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAALHTSPESPTSQLERMEVRPECEADHEGSSDLVEESLEDIEGSPELMEDSPEEVEGSP
EEEDDSSELIDGSPEAIDGLPEPGSPEPELQEPLNDDSKMESPVLQEKVHELGREIKNSV
LSSSASSVSWVPAILKKEILDDDEPVTDFLTTESQGLVTFEDVAVYFSLEEWGRLNESQK
DLYREVMQENYGILVSLGYPIPKPDVISRMERGEELWVPESPGPEEGDILTGVYTALSLW
TRDIARSTSNEREETCPFIVLVSSKESEPPGVWSAAYGVGDVPGTWGPDDSVQAPPTDLW
GGDPTNIGMVPEGQEMKPILHGGEAGAPLLPPWAFSAVVEAAGGRPETTCDVCGKVFPHR
SGLAKHRRYHAAVKPFGCEECGKGFVYRSHLAIHQRTHTGEKPFPCPDCGKRFVYKSHLV
THRRIHTGERPYRCSFCGAGFGRRSYLVTHQRTHTGERPYPCPQCGRSFSQSSALARHQA
VHTAEKPHCCPDCGRAFRLRADFQRHRRGGKCSDLREEVRREESEGAELGGEGLEPVNET
PVIERTYPELGNGFGEGEGPSHPLDFHFPLPPKSWLHGENLPMLALQDFGERVAHELVDA
PPLPGHLGSQISLIDGTAMPCDPCASGLLPFGPSVGSLLADPQPSSMLEEETPWICSDCG
KTFGRRAALAKHQRYHAGDRPHRCADCGKSFVYGSHLARHRRTHTGERPFPCPECGARFA
RGSHLAAHVRGHTGEKPFVCGVCGAGFSRRAHLTAHGRAHTGERPYACGECGRRFGQSAA
LTRHQWAHAEEKPHRCPDCGKGFGHSSDFKRHRRTHTGEKPFRCADCGRGFAQRSNLAKH
RRGHTGERPFPCPECGKRFSQRSVLVTHQRTHTGERPYACAACGRRFSQSSHLLTHMKTH
RGTTTGPAAKAEAPGQKQASRPSGEKEDSSSSKTVAEFGGSSSFVSEEPSAVFPGPSCSY
EETLM
Download sequence
Identical sequences F6S429
13616.ENSMODP00000019283 ENSMODP00000019283 ENSMODP00000019283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]