SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6S995 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6S995
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000495
Family BphP N-terminal domain-like 0.028
Further Details:      
 
Weak hits

Sequence:  F6S995
Domain Number - Region: 317-408
Classification Level Classification E-value
Superfamily t-snare proteins 0.0549
Family t-snare proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6S995
Sequence length 675
Comment (tr|F6S995|F6S995_CALJA) PAS domain containing repressor 1 {ECO:0000313|Ensembl:ENSCJAP00000007113} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PASD1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
LDGFMITLSTDGVIIYVDENISPLLGHMPSATVDKKLLSLLPDAEKNKVSEKIILKFPLF
NSETHIEFCCHLKRGNVEHGDGPAYEYVKFILNVKHICNESAVFFSSFCSSRRYAALSAK
HITWEDQFYLMGIVCVLRTQLLKRLYTRSKVTDKFILTQESDEESFVKDLSGSQDEGGHT
SMEVVCAEPITITARDAVMDDQIEITQVEQHGPQDNGNIEDSDSTYCSSTDFMDNIPESS
DLLFLQGFQFEPEVNPLYMAEPVDLEFSVDQEDSVDQRGPMDQQDPENPVDLLGETGLMD
SVDTENSEDLETAGTSAQPLQPLSPVVHSIISQEMDVIKKLKEQLEKRSQMLHDTIQDQQ
DALAVIIDQFQKQPNTSHHVVSPDSQPSEAEPMKQQKQHTGQAERSLPHPKEVKRVCDLS
SCNSFKNTRKLQEPCAAVTQQTLAAKCMAATSIQSNKEAQLLLLFALRKLNSSGTCRHQG
PFISCLLQEQPQKRNVIVGNHMLQICLQNPSCVTGPLGNNPVRFLQTQPIVVPIQIVAEQ
QLSGHQEDESQSSHPKECLELTTSQVPLVDTPNPEAISSSTTTSKSSDSTISTQEVPEDC
IHIWEQLPGPCNQTCNERGTTHCQPIYRQVWCNTLTDIGAEGPPGQQAFQGPAAYQPDQM
RNLTPEEQRDSNKQR
Download sequence
Identical sequences F6S995
ENSCJAP00000042189 ENSCJAP00000007113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]