SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6S9M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6S9M2
Domain Number 1 Region: 64-147
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 9.02e-20
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00048
Further Details:      
 
Domain Number 2 Region: 362-418
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000445
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6S9M2
Sequence length 423
Comment (tr|F6S9M2|F6S9M2_XENTR) Uncharacterized protein {ECO:0000313|Ensembl:ENSXETP00000060436} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=LOC100489197 OC=Silurana.
Sequence
CCEFLSERLQAEQIIMALFNVLGSVFQVPETRAQNVSIYYSPKESFKGRLLRRKLSKSDI
GSPSNFKHLAHVGWPSGTNLDERTDADLKKLFKLAGIKEEHLKDQEMSRKIFAVIEKKGG
MEAVRKETLRMATLAQREMPDSRYKYRSRSSTNQTPPKRQNSFPVTSHHAAKIPVTTLPS
SPFSYIASLHRMPSAQPSPLGDFPSLSPIPSPPLLLGDFSPVPTPAQNKISPQTSIEIKT
SLTDVSARPAIPPRPPTLLSAKDSPLIPLPLPSLPASVHKSSSELSFPCQPQSPASCQHN
DIQHASVPPPPPPIPPFLKKESPEKACLVLPSCPVEELHNSPLKCMMQTEKEIHRGKEKL
RDPSLFLEQIRQGVQLKSISRPSKIESSQNSTIVSALMDVIQKRHKALHGSADDETDDDE
WED
Download sequence
Identical sequences F6S9M2
ENSXETP00000060436 ENSXETP00000060436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]