SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SCP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SCP8
Domain Number 1 Region: 11-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000011
Family Ras-binding domain, RBD 0.054
Further Details:      
 
Weak hits

Sequence:  F6SCP8
Domain Number - Region: 100-123
Classification Level Classification E-value
Superfamily Second domain of FERM 0.022
Family Second domain of FERM 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6SCP8
Sequence length 128
Comment (tr|F6SCP8|F6SCP8_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000022038} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MMKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMVTLQDRLSLRYIEHFALVLEYA
GPEQNHKFLLLQDKQPLAYVVQRTHYQGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQV
ESGLGIHR
Download sequence
Identical sequences F6SCP8
ENSECAP00000022038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]