SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SEM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SEM8
Domain Number 1 Region: 1324-1486
Classification Level Classification E-value
Superfamily PH domain-like 5.47e-71
Family Pleckstrin-homology domain (PH domain) 0.00000322
Further Details:      
 
Domain Number 2 Region: 1110-1327
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.37e-53
Family DBL homology domain (DH-domain) 0.000000104
Further Details:      
 
Domain Number 3 Region: 507-622
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-20
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 4 Region: 887-995
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000128
Family PDZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6SEM8
Sequence length 1726
Comment (tr|F6SEM8|F6SEM8_MONDO) T-cell lymphoma invasion and metastasis 2 {ECO:0000313|Ensembl:ENSMODP00000029251} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=TIAM2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MGNSESQYSLQGSKNHSSSSTGAKQKPCPLKIRSIHAKDEKSCSLHGWGHGNSGTNYKSR
SLARSCLSHFKSNQPYSSRLDPMAKVSKGSAHTKHKGNVSGNYFQGKNSAFLSENGFHYI
SHEPADNHITSRDCNGHLLNCYGKNESLASTPPAEDRKSPKVLIKTLGKLDGCLRVEFHN
SSNNKVPTEDSTGPVQLLRYSPTLESETSNLTEIRRNSSTDYSASHCLSPTDSRLRSSKG
SSFSSESSWYDSPWGNAGDINELEGPYLTRSTPDTSIHSSFPSDDAKKPFNQSSSLSSLR
ELYKDATLESLPPSGIRFSDEYIGTHASLNSRVSFVSDIDVPSRAEQRGPVQYCSYTLPC
RKSKPLTEDTSKKDTLKTRMRRISDWTGSLSRKKRKLQEPKSKDGYDHLENRTDGLSAEV
LVPSQLSSLLWPGGSGQTLPQRSESTNAISSDPLRQNIYENFMRELEMSRTHVDNTETST
DTADSSSDSLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTLQKEKKLELVARRKWKQYWV
TLKGCTLLFYETYGRNSMDQSSSPRCALFAEDSVVQSVPEHPKKENVFCLSNSFGDVYLF
QATSQTDLENWVTAIHSACASLFAKKHGKEDTVRLLKNQTKNLLQKIDMDSKMKKMAELQ
LSVVSDPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAATSRPS
KLALGRLGILSVSSFHALICSRDESALRKRTLSLTQQGQSKKGLFSSLKGLDTLARKGKD
KRPSITQIFDSSGNHGFPGTQLPQSSNNSSEVDEFQHIYSSASDSGPRENIWESQTYVHF
QDNQGVTLIIKPEHRVEDILSLSCKMKQLDPSYYGLQLRRLVDDNFEYSIPALYEYMQEQ
VYDEIEIFPLSIYHVLLTKTGNITDFGFAVTAQVDEHQHLSRIFISDVLPDGLAYGEGLR
TGNEILTINGEVISDLDLRQMESLFSERSVRLTLRTNSSDTKRTLGTSWSDSDLSRDQKN
LLPPPNQSQLLEEFLDNLKKNTANDFSNVPDVTAGLKRSQTDGTLDQVPHREKTEHTFRS
AEQIAALCRSFNEVQPSTDSMEGPKEAQEPPPRPLARHLSDADRLRKVIQELMDTEKSYV
KDLTCLFELYLEPLQNETFLTQDEMESLFGSLPEMLEFQKVFLETLEDGISSSSDFNILE
TPSQFRKLLFSLGGSFLYYTDHFKLYSGFCANHIKVQKVLERAKTDKAFKAFLDARNPTK
QHASTLESYLIKPVQRVLKYPLLLKELVSLTDNESEEHYHLTEALKAMEKVASHINEMQK
IYEDYGTVFDQLVAEQSGTEKEVTELSMGELLLHSTVSWLNPFLSLGKARKDLELTVFVF
KRAVILVYKENCKLKKKLPSSSRPTHVHGDLDPFKFRWLIPLSALQVRLGNAAGTENNSI
WELIHTKSEIEGRPETTFQLCCSDCESKTNIVKVIRSILRENFRRHIKSELPLEKTCKDR
LIPLKNRIPVSAKLASSRSLRVLKNSPSNEWNSDTGKGNLLDSDECSLSSSTQSSGCHTT
ESRQESKDSSPEKYPQTCSSDFSDSLIKESDILSDEDDDFHQTLKKGSPTKDIEIQFQRL
KISEDSEGDSTADQQPRTEVGNNLNSVAHPKLVRGHFCPIKRKANSTKRDRGTLLTLQAR
HQSLDSKSENANIDLNSILEREFSVQSLTSVVNEECFYETDSHGKS
Download sequence
Identical sequences F6SEM8
ENSMODP00000029251 XP_007484853.1.35504 XP_007484854.1.35504 XP_007484855.1.35504 XP_007484856.1.35504 XP_007484857.1.35504 ENSMODP00000029251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]