SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SF33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SF33
Domain Number 1 Region: 126-270,340-407
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-17
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6SF33
Sequence length 551
Comment (tr|F6SF33|F6SF33_CALJA) Sodium voltage-gated channel alpha subunit 7 {ECO:0000313|Ensembl:ENSCJAP00000045969} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=SCN7A OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MLASLEPKGLVPFTRESFERIQQRIAKTHNEEHEEEDLKPNTDLEVGKELPFTYGNLSRG
MVSEPLEDVDPYYHEKKNTFIVLNKNRTIFRFNAASILCTLSPFNCIRGTTIKVLVHPYP
FLLASTLFRLFILISVLTDCIFMSLTNLPKWRPVVENTLLGIYTFEILVKLFARGVWAGS
FSFLGDPWNWLDFSVTVFEIIIRYSPLSFIPMLQTVRTLRILKIIYLNQGLKSLVGVLIC
CVKKLTGVIILTLFFLSIFSLIGMGLFMGNLKHKCFRWPQENENETLHNRTGNPYYIRET
ENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWALLALFRLMTQ
DYPEALYHQILYASGKVYMIFFVVVSFWFSFYMASLFLGILAMAHEEEKQRVGETTKNTE
PKFQKTGKELQGGNETAEAKAIQIEMKKRSPASTDTSLDVLEDATLRHKEELEKSKKICP
LCWYKFAETFLIWNCSPCWLKLKEFVHRIITAPFTDLFLFICIILNVSFLALEHYPMSEQ
TSNLLSTGNLV
Download sequence
Identical sequences F6SF33
ENSCJAP00000045969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]