SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SLA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SLA9
Domain Number 1 Region: 442-542
Classification Level Classification E-value
Superfamily PH domain-like 8.49e-24
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Weak hits

Sequence:  F6SLA9
Domain Number - Region: 53-198,442-462
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00345
Family IMD domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6SLA9
Sequence length 548
Comment (tr|F6SLA9|F6SLA9_XENTR) Pleckstrin homology-like domain, family B, member 3 {ECO:0000313|Ensembl:ENSXETP00000033141} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=phldb3 OC=Silurana.
Sequence
NRSIRKVETNIFSDEDLDKLKLRDEKKKIKDLEQKISEGKSQLEKQPESLREQLRKNIQE
MTETMEAAVKSFEDLEFQQLESESSRDEERESSYRQISQDISKRQNELNRRKDKVLRLEE
HIQGAEDQAQVERQRLSEENTRVFQSLNKEKDQLESLNALSGKDQGQNEKPQSSTRKKEG
SRLLREPTACPKEGQVLHLSGQLTVHSLSMATTSQMGSYGIKKKHSVITSSGKSGGLLYN
VRSDVTILSCRLTMAMTYTWQELSSGPSVLQDPIEPPCFPQLTREMSHDSSHSLHFPKRI
NLAYLSLGIYSAALVPSCVFFMNSWNFCSLRPLPKIAEIERQLREALAEKERLLKARVSK
DLSAVSQESEEEKRAAKEMTRRLESSQNQVKTEEPAPVTAKPALPETKGEPRAPAPLDLR
SHLEASGHCVETCPHVRVSPTCCKGYLVKMGGRIKTWRKRWFVFDRQKRRLAYYTDKDEV
KLKGVIYFQAIEEVYYDHLRSAFKSPHPKLTFCLKTFERLFCMVAPTPEAMRIWMDVMVT
AAEENSRY
Download sequence
Identical sequences F6SLA9
ENSXETP00000033141 ENSXETP00000033141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]