SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SP47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SP47
Domain Number 1 Region: 665-693
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000445
Family CCCH zinc finger 0.0028
Further Details:      
 
Weak hits

Sequence:  F6SP47
Domain Number - Region: 774-794
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000144
Family CCCH zinc finger 0.0056
Further Details:      
 
Domain Number - Region: 739-771
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00288
Family CCCH zinc finger 0.0052
Further Details:      
 
Domain Number - Region: 721-743
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0286
Family CCCH zinc finger 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6SP47
Sequence length 885
Comment (tr|F6SP47|F6SP47_MONDO) Zinc finger CCCH-type containing 3 {ECO:0000313|Ensembl:ENSMODP00000014239} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ZC3H3 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MEEKEQLRRQIRLLQGLIDDYKNLHGNAPASSTTQWHPSTYSSGRVFGPRYSRPGRRGFP
PHHGPSWRKKYSLVNRPSGSMDQPGDNGSTSVAQPSLSSEDSQDPSSQHYVLERQVQLNS
DQNMVIKIKPPPKSDSLVDSDTYRASVDDNEGSHRIDQRPKEGEGDPPGGKLQGPRPTKL
EGSSSKEDPLLVCLKEPGKPRVVRSMGITPGGSHEPRRTVSESAIVLKSKPTSFQSPRSG
LGRKLGCSLPSSLGLQHSVSDRDSLLSHTSSPTQAEVSVTIRKQGHSPKQVRENCLLVPC
RTNKFRKNNYRWVNSSVKNPRAIRRYSSPRTAPETSRKVSFGTYERAGKSQLRADLDTKS
KKASVTSKPGTSTSKYKWKASSPASSSSSSFLWHSEPASRDRPSHPSAGDSRTPILNRAG
VGASGLKTPYGEAPLSPYKVKSRTKIIRRRGSTSLPVDKKSSPSSSGTPKNHYSLRRRNS
LRGKVTPVLKRTPNKGLVQITKHRLCRLQPSRSTVPAKEAPALHALRTSPSNKVIKTRYR
IVKKNFPSSFSLPAFNIPSSTWKARRLTASRERLNRMRQSALSGKAQTSPPTWKSKGYRC
IGGVMYRVSANKLSKTSGRPQDGNSKHLLRGGELDETTSCSKSPYSRAIQRSLAIIRQAR
QKKEKKRDYCMYYNRFGKCNRGQHCPYIHDPEKVAVCTRFLRGTCKKTDGTCPFSHHVSK
EKMPVCSYFLKGICNNSNCPYSHVYVSKKAEVCVDFLKGYCPMGEKCKKKHMLLCPDFSR
KGSCPRGLQCQLLHRPRKRLNRRSVPPHPPETSDSPTKWKRVRSAAPRPPSSSQQPQPSG
TQQPALLYALGSVSSSCCSSSSSSSSSSSSSSSSSSSSIPRILHH
Download sequence
Identical sequences F6SP47
ENSMODP00000014239 ENSMODP00000014239 13616.ENSMODP00000014239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]