SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SPK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SPK9
Domain Number 1 Region: 832-1116
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.19e-79
Family Protein kinases, catalytic subunit 0.000000000396
Further Details:      
 
Domain Number 2 Region: 559-737
Classification Level Classification E-value
Superfamily Fibronectin type III 3.77e-23
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 3 Region: 352-449
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000587
Family I set domains 0.039
Further Details:      
 
Domain Number 4 Region: 444-583
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000315
Family Fibronectin type III 0.0055
Further Details:      
 
Domain Number 5 Region: 131-213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000191
Family I set domains 0.06
Further Details:      
 
Domain Number 6 Region: 214-334
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000628
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6SPK9
Sequence length 1138
Comment (tr|F6SPK9|F6SPK9_MONDO) Tyrosine kinase with immunoglobulin like and EGF like domains 1 {ECO:0000313|Ensembl:ENSMODP00000014225} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=TIE1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MGQVGPLLLLVLLTSHEGAAMDLTLLADLRLTDPQRFFLTCVSGEPGAGRGLDVWDPPLL
LEKDDRIVRAFPPRQPLHSTRNGSRHITLRGFSQPSDLVGVFSCIGGTGARRTRVIYVHN
SPGAHLLPEKVTHTVNAGDTATLSARVRTEKQVDVIWKSNGSYFYTLDWHEARDGKFTMQ
LPNLRASDGGIYSATYLQGNPLASAFFRVIVRGCSAGRWGPGCAKDCPSCLHGGICHDQN
GECVCPPGFTGTRCEQACREGRFGQGCQQQCPGASRCRGLTFCLPDPYGCSCGAGWGGTQ
SQEACAPGWFGASCYLQCRCQNGGTCDRFTGCVCPSGWHGEHCEKSDRIPEIVNMASELD
FNMGAKPVVSCAATGNPPPVRGSMQLQRPDGTIFMPSKAIMEVDKTTSEFQVPPVSPTDS
GLWECRVSTSGGQDSRHFRVNIKVPPVPMDPPRLLARLSRQLVVSPLVPFSGDGPISSVR
LRYRPLDSSAAWSTIVVDPSENVTLMNLRPQTGYEVLVQLSRPGEGGEGKWGPASVMATD
CLEPTLRPRLEDWHVEAPDQLQVTWSLPAGPGPLVGDGFLLHLWDPAARGQELYKNVTSL
QARAATLSGLVPGTFYQLEARLYHCTRLGPASQPARVLLPPTGPPAPRLLRAQALSDSAI
RLTWQRPEARAGAIAKYIVELQAVGGSGEPLWVDTEGAEDTSTIIHSLNASTRYHFRVRA
SAQGPGDWSDVAEESTLGNGLESEGPAQQSRGASPGLDRQLVLAIVGSVSATCLTILAAL
LALVCIRKSCLHRRRTFTYQSGSGEETVLQFSSGTLTLTRRPKPQPEPLSYPVLEWEDIT
FEDLIGEGNFGQVLRAMIKKDGLQMNAAVKMLKEFASENDHRDFAGELEVLCKLGHHPNI
INLLGACENRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAHEHGTASTLTSQQLLRFA
SDVSKGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTVGRLPVRWM
AIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDD
EVYELMRQCWRDRPYERPTFAQISLQLGRMLEARKAYVNMALFENFIYAGIDAHAEEA
Download sequence
Identical sequences F6SPK9
XP_007480360.1.35504 ENSMODP00000014225 ENSMODP00000014225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]