SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SQ27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SQ27
Domain Number 1 Region: 508-749
Classification Level Classification E-value
Superfamily vWA-like 2.95e-76
Family Trunk domain of Sec23/24 0.00000547
Further Details:      
 
Domain Number 2 Region: 704-842
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.22e-39
Family beta-sandwich domain of Sec23/24 0.0007
Further Details:      
 
Domain Number 3 Region: 951-1099
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 9.42e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.0011
Further Details:      
 
Domain Number 4 Region: 282-474
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 6.8e-29
Family beta-sandwich domain of Sec23/24 0.0017
Further Details:      
 
Domain Number 5 Region: 846-947
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.18e-25
Family Helical domain of Sec23/24 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6SQ27
Sequence length 1100
Comment (tr|F6SQ27|F6SQ27_HORSE) SEC24 homolog A, COPII coat complex component {ECO:0000313|Ensembl:ENSECAP00000003361} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=SEC24A OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MSQPGIPASGGVPTSLQAQNGAASASGSPYTNGPVQNALMSSQVSVSQGYNSQLSGSYPH
PIPAKTLNPVSEQPNYGDSQTVSPLSNYQGPGRTINRPPVASNPVTGSLHSGPVPRMPLP
TSQNPAATPMPSGSFLRGANIPPPLNWQYNYPSTGSQTNRCPRASSQPTLSGNTNSTSHQ
YVSSGDPSLQNNFIKSGPMPPLVNPPLPTTFQPGAPLGPPPTGGPPTVRALTPQKSSHRA
MPQPSFNSPINQEGITSNTNNGSMVVHNSYDEIEGGGFLATPQLTNKNPTMSRSVGYSYP
SLPPGYQNTAPPSTAGMPPSSLNYPSGPQAFTQAPFGASHLTASMSGLSLHPEGLRVVNL
LQERNMLPSTPLQPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHP
FKDLVQLPVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFMYNPLTRV
YGEPHRRPEVQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNL
DLLPGNTRTKIGFITFDSTIHFYSLQEGLSQPQMLIVSDIEDVFIPMPENLLVNLNESKE
LVQDLLKTLPQMFTKTLETQSALGPALQAAFKLMSPTGGRMTVFQTQLPTLGVGALKPRE
EPNQRSSAKEIHLTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGSV
YYYPSYHHQHNPVQVQKLQKELQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDL
LSLPNVNPDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNE
VFLGADVQAISGLLANMAVDRSVTASLSDARDALVNAVIDSLSAYRSSVLSNQQPGLMVP
FSLRLFPLFVLALLKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLYRVDNLS
DEGALNINDRTIPQPPLLQLSVEKLSRDGAFLMDAGSVLMLWVGKNCGQNFLSQVLGVQN
YALIPQTMTDLPELDTPESARTIAFISWLRDQRPFFPILYVIRDESPMKANFLQNMVEDR
TESALSYYEFLLHIQQQVNK
Download sequence
Identical sequences F6SQ27
ENSECAP00000003361 ENSECAP00000003361 XP_001504440.1.31192 XP_008508388.1.77740 9796.ENSECAP00000003361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]