SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SQZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SQZ6
Domain Number 1 Region: 73-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.51e-17
Family Complement control module/SCR domain 0.00024
Further Details:      
 
Domain Number 2 Region: 198-259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 3 Region: 130-200
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000917
Family Complement control module/SCR domain 0.00063
Further Details:      
 
Domain Number 4 Region: 10-83
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000249
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6SQZ6
Sequence length 261
Comment (tr|F6SQZ6|F6SQZ6_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000010260} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
VLILFFLDACGDPLRYESMKLKGVAQPRYSPGATVEYECRLGYMLKRPPLPTSARCQANN
TWTPLQEACTRKSCPHPGDPINGKVEYVNGTLTFGSQIHYFCNEGFNLIGTKILYCELVG
ETVNWSDNPPLCQVMYCRPPPKIQNGKHSRSDQEEFRYGEVVVYTCDPSNGPDEYSLVGE
SRLVCSGNDVWSSKPPECKVVKCEPPVLENGRVVSGFGKKFYYKATVVFDCLPGFYLSGN
NTIVCGANSAWEPAIPTCIKG
Download sequence
Identical sequences F6SQZ6
9796.ENSECAP00000010260 ENSECAP00000010260 ENSECAP00000010260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]