SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SR87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SR87
Domain Number 1 Region: 115-385
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.21e-38
Family Eukaryotic proteases 0.00023
Further Details:      
 
Domain Number 2 Region: 21-82
Classification Level Classification E-value
Superfamily GLA-domain 1.03e-22
Family GLA-domain 0.00062
Further Details:      
 
Domain Number 3 Region: 71-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family EGF-type module 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6SR87
Sequence length 385
Comment (tr|F6SR87|F6SR87_HORSE) Protein Z, vitamin K dependent plasma glycoprotein {ECO:0000313|Ensembl:ENSECAP00000022230} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=PROZ OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
AVFLSASKANTVLARWKRAGSYLLEELFEGNLEKECYEEICVYEEAREVFENDAITGEFW
TRYMGGSPCTSQPCRNNGSCQDSIRSYTCTCAPGYEGRDCAFAKNECHPLRTDGCQHFCH
PGHESYRCSCAKGYKLGRDRKSCIPHEKCACGILKSESVARPPNSTQSLQVFPWQVKLTN
SKGEDFCGGVIIQENFVLTTAKCSLLHKNITVKTNFPRTSRDPLTIAVQSVHVHMRYEEE
TGDNDVSLLELGLPIQCPDAGLPVCMPERDFAERALIPRTEGLLSGWTLNGSRLGNAPTQ
LPVTHMDSEECGQALDVTVTTRTYCERGTVAGGVRWAEGSMAAREHEGTWFLTGILRSAP
TDEHGRAFLLTKVSRYSLWFRQIMK
Download sequence
Identical sequences F6SR87
9796.ENSECAP00000022230 ENSECAP00000022230 ENSECAP00000022230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]