SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ST32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ST32
Domain Number 1 Region: 2-137
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.97e-41
Family Carbonic anhydrase 0.000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6ST32
Sequence length 164
Comment (tr|F6ST32|F6ST32_MOUSE) Carbonic anhydrase 4 {ECO:0000313|Ensembl:ENSMUSP00000103711} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Car4 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
XMHIVHKKLTSSKEDSKDKFAVLAFMIEVGDKVNKGFQPLVEALPSISKPLRESSLQDML
PPSTKMYTYFRYNGSLTTPNCDETVIWTVYKQPIKIHKNQFLEFSKNLYYDEDQKLNMKD
NVRPLQPLGKRQVFKSHAPGQLLSLPLPTLLVPTLTCLVANFLQ
Download sequence
Identical sequences F6ST32
ENSMUSP00000103711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]