SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SUR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SUR1
Domain Number 1 Region: 276-474
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.59e-34
Family Pancreatic carboxypeptidases 0.0000248
Further Details:      
 
Domain Number 2 Region: 13-132
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.7e-31
Family Frizzled cysteine-rich domain 0.00092
Further Details:      
 
Domain Number 3 Region: 474-553
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 3.14e-18
Family Carboxypeptidase regulatory domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6SUR1
Sequence length 625
Comment (tr|F6SUR1|F6SUR1_HORSE) Carboxypeptidase Z {ECO:0000313|Ensembl:ENSECAP00000010744} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=CPZ OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
GGCHRPSAADSATCVDLQLRTCSDATYNRTAFPTLLEHRSREAVESSSEYILLSVLHHLL
EGQCNPDLRLLGCAVLAPRCEGGRVRRPCRRMCEALREACLPAFDAIDMAWPYFLDCGHY
FASEEDGCYDPLEALRGRGLWGPGGRTGQPSQSAQLGMHSRKSTAGPLQRTALHWLGVLR
PHGLRGQWEGLQRDALCVNSRIAEHPLPAPHILSSCCIHGSHFAGRQELSVPSVGLGEII
LGNSGTKLPLSSAFFPLKNHREQKQNHRASEALRGKHSLTSGRQNAQNLDLNRNFPDLTS
EYYRLASSRNARSDHIAIPQHYWWGKVAPETKAIMKWMRNTPFVLSDSLHGDLVVSYPFD
FSKHPQEEKMFSPTPDEKMFKLLARAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYS
FTGGMSDFNYLHSNCFEITVELGCVKFPPEEALYTIWQHNKEPLLNFVEMVHRGIKGVVM
DKFGKPIKNARIVVKGIRHDITTAPDGDYWRLLPPGSHIVIAQAPGYSKVIKKVTIPARL
KKAGRVDFILQPLGTGPKTSLLGPRRSGPGLRGPAGGAGPHREPEDPDQEPLGARRQPTA
GGSKPWWWSYFTSLSQHKPRWLLKY
Download sequence
Identical sequences F6SUR1
9796.ENSECAP00000010744 ENSECAP00000010744 ENSECAP00000010744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]