SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SXY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6SXY2
Domain Number - Region: 35-134
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00102
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6SXY2
Sequence length 181
Comment (tr|F6SXY2|F6SXY2_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000003315} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
SIMKNTLQAREQDKTPEKGLKETEASDLLDKEFKQNIMRMLRDIGRRLDEHSELMSKELE
DIKRKQSERKNTILEMKDSLERLNSRVEDAEERIRELDERLEETTQAAQKKEKRIRQNER
SLRELWDNIKHANIQIIGVPEGEERHKGAENLFEEIINENFPILRKETHIQVQEAQSSKQ
D
Download sequence
Identical sequences F6SXY2
ENSECAP00000003315 ENSECAP00000003315 9796.ENSECAP00000003315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]