SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SZK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SZK3
Domain Number 1 Region: 446-857
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.53e-115
Family PIWI domain 0.0043
Further Details:      
 
Domain Number 2 Region: 108-429
Classification Level Classification E-value
Superfamily PAZ domain 1.88e-73
Family PAZ domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6SZK3
Sequence length 857
Comment (tr|F6SZK3|F6SZK3_MONDO) Piwi like RNA-mediated gene silencing 4 {ECO:0000313|Ensembl:ENSMODP00000000258} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=PIWIL4 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MTGRARVRARGVYRSSESRLSGQSQSSAWSHLAARDREAATSSGLLGIKRIPQKSEEGIS
AGDGAECTLVQRGGRTQHRNFLELGIHTREKLEHVKDCKTGTSGAPVKLVTNIFNLALPR
EWHLFQYHVTFSPELASKRLRIALLCSHSKFQKKAKVFDGSILFLSEKLEEKVTTLSGET
RPGICITITVTLTSELPSCSPVCIQFFNIIFRKILKKLSMYQIGRNFYSPVDPVEIPQHK
LSLWPGFAISVSQLENKLMFTANVTHKVLRNETVLEFMTDLYNRKDKSRFIETCEKELLG
SVVLTRYNNKTYRIDDIDWSVKPTDTFQKRDGTRITYFDYYKQQYDIKLSDLNQPMLVSQ
LKRKGTGNEEARIAHLIPELCYFTGLSKRMTSDFRLMKDLATNTHLNPLLRQQRLSRLAD
NIQRNKEARFELETWGLQFGCQMSLTGRVVPSEKILMQDTICQPMSSANWSKDMRNCKLL
GARALNNWLIVCSHRNEDVAENLLNCLRRVSGPMGFHIEKPKITKVQENTTAFIRAIQQH
TNLDLQLVMCILPSNQKDCYDSIKRFLSLDHPVPSQCVLARTLIRQGMMMSIATKIAMQM
VSKLGGELWAVEIPLKSLMVVGIDVNKEACAKGRSAVGFVASSNSRITRWFSRCILQNTK
TNIADCLKVCMKGALDKWYRYNHCFPTRIIVYRDGVGDGQLQTIVDYEVPQLLSSLRDSN
PNYSPKVSVIVVRKSCMPRFFTEMNSTLQNPPLGTVVDSEATRPEWQVYMYDFYLISQAA
YQGTVTPTYYNVIYDDNGLKPDHMQRLTYKLCHLYYNWPGLIKIPAPCQYAHKLTFLVGQ
SIHREPSMELADYLFYL
Download sequence
Identical sequences F6SZK3
ENSMODP00000000258 ENSMODP00000000258 13616.ENSMODP00000000258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]